INMT Polyclonal AntibodyINMT Polyclonal Antibody
Move your mouse over image or click to enlarge

INMT Polyclonal Antibody

Cat# Size Price Qty Buy
A14391-200ul 200ul
£332.50
A14391-100ul 100ul
£192.50
A14391-50ul 50ul
£113.75
A14391-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14391
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names INMT; TEMT; indolethylamine N-methyltransferase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human INMT (NP_006765.4).
Reactivity Mouse
Gene ID 11185
Calculated MW 28kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents