ILF2 Polyclonal AntibodyILF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ILF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13320-200ul 200ul
£332.50
A13320-100ul 100ul
£192.50
A13320-50ul 50ul
£113.75
A13320-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13320
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ILF2; NF45; PRO3063; interleukin enhancer-binding factor 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2).
Reactivity Human, Mouse
Gene ID 3608
Calculated MW 43kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents