IL3RA Polyclonal AntibodyIL3RA Polyclonal Antibody
Move your mouse over image or click to enlarge

IL3RA Polyclonal Antibody

Cat# Size Price Qty Buy
A3926-200ul 200ul
£332.50
A3926-100ul 100ul
£192.50
A3926-50ul 50ul
£113.75
A3926-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3926
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL3RA; CD123; IL3R; IL3RAY; IL3RX; IL3RY; hIL-3Ra; interleukin-3 receptor subunit alpha
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1).
Reactivity Human, Mouse, Rat
Gene ID 3563
Calculated MW 34kDa/43kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30870654
Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENS
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents