IL1RAPL1 Polyclonal AntibodyIL1RAPL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

IL1RAPL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3378-200ul 200ul
£332.50
A3378-100ul 100ul
£192.50
A3378-50ul 50ul
£113.75
A3378-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3378
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL1RAPL1; IL1R8; IL1RAPL; MRX10; MRX21; MRX34; OPHN4; TIGIRR-2; interleukin-1 receptor accessory protein-like 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1).
Reactivity Human, Mouse, Rat
Gene ID 11141
Calculated MW 79kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents