IL1F10 Polyclonal AntibodyIL1F10 Polyclonal Antibody
Move your mouse over image or click to enlarge

IL1F10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13133-200ul 200ul
£332.50
A13133-100ul 100ul
£192.50
A13133-50ul 50ul
£113.75
A13133-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13133
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL1F10; FIL1-theta; FKSG75; IL-1HY2; IL-38; IL1-theta; IL1HY2; interleukin-1 family member 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human IL1F10 (NP_115945.4).
Reactivity Mouse
Gene ID 84639
Calculated MW 16kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents