IL17RE Polyclonal AntibodyIL17RE Polyclonal Antibody
Move your mouse over image or click to enlarge

IL17RE Polyclonal Antibody

Cat# Size Price Qty Buy
A14315-200ul 200ul
£332.50
A14315-100ul 100ul
£192.50
A14315-50ul 50ul
£113.75
A14315-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14315
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL17RE; interleukin-17 receptor E
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-260 of human IL17RE (NP_705613.1).
Reactivity Human, Mouse
Gene ID 132014
Calculated MW 30kDa/43kDa/58kDa/61kDa/74kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRTWWALFSTKPWCVRVWHCSRCLCQHLLSGGSGLQRGLFHLLVQKSKKSSTFKFYRRHKMPAPAQRKLLPRRHLSEKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCIEASYLQEDTVRRKKCP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents