IGHMBP2 Polyclonal AntibodyIGHMBP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

IGHMBP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16053-20ul 20ul
£77.00
A16053-50ul 50ul
£113.75
A16053-100ul 100ul
£192.50
A16053-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16053
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IGHMBP2; CATF1; CMT2S; HCSA; HMN6; SMARD1; SMUBP2; ZFAND7; DNA-binding protein SMUBP-2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human IGHMBP2 (NP_002171.2).
Reactivity Human, Mouse, Rat
Gene ID 3508
Calculated MW 109kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence PYNLQVDLLRQSLVHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGKSLASEAPSQPSLNGGSPEGV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents