IGFBP3 Polyclonal AntibodyIGFBP3 Polyclonal Antibody
Move your mouse over image or click to enlarge

IGFBP3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16052-20ul 20ul
£77.00
A16052-50ul 50ul
£113.75
A16052-100ul 100ul
£192.50
A16052-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16052
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IGFBP3; BP-53; IBP3; insulin-like growth factor-binding protein 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP3 (NP_000589.2).
Reactivity Human, Mouse
Gene ID 3486
Calculated MW 31kDa/32kDa
Observed MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents