IGFBP1 Polyclonal AntibodyIGFBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

IGFBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A2981-200ul 200ul
£332.50
A2981-100ul 100ul
£192.50
A2981-50ul 50ul
£113.75
A2981-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A2981
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IGFBP1; AFBP; IBP1; IGF-BP25; PP12; hIGFBP-1; insulin-like growth factor-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-259 of human IGFBP1 (NP_000587.1).
Reactivity Human, Mouse, Rat
Gene ID 3484
Calculated MW 27kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents