IFNGR2 Polyclonal AntibodyIFNGR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFNGR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14221-200ul 200ul
£332.50
A14221-100ul 100ul
£192.50
A14221-50ul 50ul
£113.75
A14221-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14221
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFNGR2; AF-1; IFGR2; IFNGT1; IMD28; interferon gamma receptor 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human IFNGR2 (NP_005525.2).
Reactivity Human, Mouse, Rat
Gene ID 3460
Calculated MW 37kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence DNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents