IFIT3 Polyclonal AntibodyIFIT3 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFIT3 Polyclonal Antibody

Cat# Size Price Qty Buy
A3924-200ul 200ul
£332.50
A3924-100ul 100ul
£192.50
A3924-50ul 50ul
£113.75
A3924-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3924
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFIT3; CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G; cig41; interferon-induced protein with tetratricopeptide repeats 3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-331 of mouse IFIT3 (NP_034631.1).
Reactivity Human, Mouse, Rat
Gene ID 15959
Calculated MW 47kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS
Sensitivity WB,1:500 - 1:1000|IHC,1:100 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents