IFIT3 Polyclonal AntibodyIFIT3 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFIT3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13317-200ul 200ul
£332.50
A13317-100ul 100ul
£192.50
A13317-50ul 50ul
£113.75
A13317-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13317
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFIT3; CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G; cig41; interferon-induced protein with tetratricopeptide repeats 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 291-490 of human IFIT3 (NP_001540.2).
Reactivity Human, Mouse
Gene ID 3437
Calculated MW 55kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents