IFIT2 Polyclonal AntibodyIFIT2 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFIT2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13760-200ul 200ul
£332.50
A13760-100ul 100ul
£192.50
A13760-50ul 50ul
£113.75
A13760-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13760
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFIT2; G10P2; GARG-39; IFI-54; IFI-54K; IFI54; IFIT-2; ISG-54 K; ISG-54K; ISG54; P54; cig42; interferon-induced protein with tetratricopeptide repeats 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4).
Reactivity Human
Gene ID 3433
Calculated MW 54kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents