IFI27 Polyclonal AntibodyIFI27 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFI27 Polyclonal Antibody

Cat# Size Price Qty Buy
A14174-200ul 200ul
£332.50
A14174-100ul 100ul
£192.50
A14174-50ul 50ul
£113.75
A14174-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14174
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFI27; FAM14D; ISG12; ISG12A; P27; interferon alpha inducible protein 27
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFI27 (NP_005523.3).
Reactivity Rat
Gene ID 3429
Calculated MW 11kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents