IDUA Polyclonal AntibodyIDUA Polyclonal Antibody
Move your mouse over image or click to enlarge

IDUA Polyclonal Antibody

Cat# Size Price Qty Buy
A13779-200ul 200ul
£332.50
A13779-100ul 100ul
£192.50
A13779-50ul 50ul
£113.75
A13779-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13779
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IDUA; IDA; MPS1; alpha-L-iduronidase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-653 of human IDUA (NP_000194.2).
Reactivity Mouse
Gene ID 3425
Calculated MW 72kDa/73kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents