IDH3B Polyclonal AntibodyIDH3B Polyclonal Antibody
Move your mouse over image or click to enlarge

IDH3B Polyclonal Antibody

Cat# Size Price Qty Buy
A13742-200ul 200ul
£332.50
A13742-100ul 100ul
£192.50
A13742-50ul 50ul
£113.75
A13742-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13742
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IDH3B; RP46; isocitrate dehydrogenase 3 (NAD(+)) beta
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2).
Reactivity Human, Mouse, Rat
Gene ID 3420
Calculated MW 25kDa/41kDa/42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents