ICAM5 Polyclonal AntibodyICAM5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ICAM5 Polyclonal Antibody

Cat# Size Price Qty Buy
A4156-200ul 200ul
£332.50
A4156-100ul 100ul
£192.50
A4156-50ul 50ul
£113.75
A4156-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4156
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ICAM5; TLCN; TLN; intercellular adhesion molecule 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-180 of human ICAM5 (NP_003250.3).
Reactivity Human, Mouse, Rat
Gene ID 7087
Calculated MW 97kDa
Observed MW 115kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents