HYAL3 Polyclonal AntibodyHYAL3 Polyclonal Antibody
Move your mouse over image or click to enlarge

HYAL3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14075-200ul 200ul
£332.50
A14075-100ul 100ul
£192.50
A14075-50ul 50ul
£113.75
A14075-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14075
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HYAL3; HYAL-3; LUCA-3; LUCA3; hyaluronidase-3
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 198-417 of human HYAL3 (NP_003540.2).
Reactivity Human
Gene ID 8372
Calculated MW 15kDa/18kDa/43kDa/46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents