HVCN1 Polyclonal AntibodyHVCN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HVCN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14153-200ul 200ul
£332.50
A14153-100ul 100ul
£192.50
A14153-50ul 50ul
£113.75
A14153-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14153
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HVCN1; HV1; VSOP; voltage-gated hydrogen channel 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HVCN1 (NP_115745.2).
Reactivity Mouse
Gene ID 84329
Calculated MW 27kDa/29kDa/31kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents