Human LL-37, Antibacterial Peptide AssayLite™Antibody (RPE Conjugate)Human LL-37, Antibacterial Peptide AssayLite™Antibody (RPE Conjugate)
Move your mouse over image or click to enlarge

Human LL-37, Antibacterial Peptide AssayLite™Antibody (RPE Conjugate)

Purified antibody validated for specificity and sensitivity.
Cat# Size Price Qty Buy
22445-05051 150 ug £350.00

Additional Information

Property Value or Rating
Manufacturer Assaypro, LLC.
Product Type Polyclonal, Primary Antibodies
Species Human
Assay Format IgG-RPE Conjugate
Product Size 150 ug
Purity Affinity Purified
Presentation Lyophilized from PBS pH 7.4, 20 mg/ml BSA, 0.02% Sodium Azide, and 4% Trehalose
Storage 2-8C, Do Not Freeze
Host Rabbit
Immunogen [LL-37, 37 aa] conjugated to KLH
Antibody Type Polyclonal
Clone None
Isotype None
Conjugate R-Phycoerythrin (RPE) conjugated
Applications FACS, ICC, IF, IHC
Entrez Gene 820
Omim 600474
UniProt P49913
UniGene Hs.51120
Alternate Names Cathelicidin Antimicrobial Peptide, Antibacterial Peptide LL-37, 18 kDa Cationic Antimicrobial Protein, CAP-18, hCAP-18, FALL-39 Peptide Antibiotic, Antibacterial Peptide FALL-39, HSD26, CAMP

Related Documents