Human LL-37, Antibacterial Peptide AssayLite™ Antibody (PerCP Conjugate)

Purified antibody validated for specificity and sensitivity.

Cat# Size Price Qty Buy
22445-05071 150 ug £390.00

Additional Information

Property Value or Rating
Manufacturer Assaypro, LLC.
Product Type Polyclonal, Primary Antibodies
Species Human
Assay Format IgG-PerCP Conjugate
Product Size 150 ug
Purity Affinity Purified
Presentation Lyophilized from PBS pH 7.4, 20 mg/ml BSA, and 0.02% Sodium Azide
Storage 2-8C, Do Not Freeze
Host Rabbit
Immunogen [LL-37, 37 aa] conjugated to KLH
Antibody Type Polyclonal
Conjugate PerCP conjugated
Applications FACS, IF
Entrez Gene 820
Omim 600474
UniProt P49913
UniGene Hs.51120

Related Documents