HSPBP1 Polyclonal AntibodyHSPBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HSPBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4574-200ul 200ul
£332.50
A4574-100ul 100ul
£192.50
A4574-50ul 50ul
£113.75
A4574-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4574
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HSPBP1; FES1; hsp70-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-359 of human HSPBP1 (NP_036399.3).
Reactivity Human, Mouse
Gene ID 23640
Calculated MW 28kDa/39kDa/44kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents