HSPB6 Polyclonal AntibodyHSPB6 Polyclonal Antibody
Move your mouse over image or click to enlarge

HSPB6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14158-200ul 200ul
£332.50
A14158-100ul 100ul
£192.50
A14158-50ul 50ul
£113.75
A14158-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14158
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HSPB6; HEL55; Hsp20; PPP1R91; heat shock protein beta-6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HSPB6 (NP_653218.1).
Reactivity Human, Mouse, Rat
Gene ID 126393
Calculated MW 17kDa
Observed MW 17kDa/24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents