HSPA13 Polyclonal AntibodyHSPA13 Polyclonal Antibody
Move your mouse over image or click to enlarge

HSPA13 Polyclonal Antibody

Cat# Size Price Qty Buy
A4132-200ul 200ul
£332.50
A4132-100ul 100ul
£192.50
A4132-50ul 50ul
£113.75
A4132-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4132
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HSPA13; STCH; heat shock 70 kDa protein 13
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-471 of human HSPA13 (NP_008879.3).
Reactivity Human, Mouse, Rat
Gene ID 6782
Calculated MW 51kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents