HSD11B1 Polyclonal AntibodyHSD11B1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HSD11B1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14000-200ul 200ul
£332.50
A14000-100ul 100ul
£192.50
A14000-50ul 50ul
£113.75
A14000-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14000
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HSD11B1; 11-DH; 11-beta-HSD1; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1; hydroxysteroid 11-beta dehydrogenase 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-292 of human HSD11B1 (NP_005516.1).
Reactivity Human, Rat
Gene ID 3290
Calculated MW 32kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents