HSCB Polyclonal AntibodyHSCB Polyclonal Antibody
Move your mouse over image or click to enlarge

HSCB Polyclonal Antibody

Cat# Size Price Qty Buy
A15961-20ul 20ul
£77.00
A15961-50ul 50ul
£113.75
A15961-100ul 100ul
£192.50
A15961-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15961
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HSCB; DNAJC20; HSC20; JAC1; HscB mitochondrial iron-sulfur cluster cochaperone
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human HSCB (NP_741999.3).
Reactivity Human
Gene ID 150274
Calculated MW 27kDa
Observed MW 27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents