HS2ST1 Polyclonal AntibodyHS2ST1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HS2ST1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13837-200ul 200ul
£332.50
A13837-100ul 100ul
£192.50
A13837-50ul 50ul
£113.75
A13837-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13837
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HS2ST1; dJ604K5.2; heparan sulfate 2-O-sulfotransferase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human HS2ST1 (NP_001127964.1).
Reactivity Human, Mouse, Rat
Gene ID 9653
Calculated MW 26kDa/34kDa/41kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents