HRH2 Polyclonal AntibodyHRH2 Polyclonal Antibody
Move your mouse over image or click to enlarge

HRH2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14170-200ul 200ul
£332.50
A14170-100ul 100ul
£192.50
A14170-50ul 50ul
£113.75
A14170-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14170
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HRH2; H2R; histamine H2 receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HRH2 (NP_001124527.1).
Reactivity Human, Mouse
Gene ID 3274
Calculated MW 40kDa/44kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents