HOXC4 Polyclonal AntibodyHOXC4 Polyclonal Antibody
Move your mouse over image or click to enlarge

HOXC4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13856-200ul 200ul
£332.50
A13856-100ul 100ul
£192.50
A13856-50ul 50ul
£113.75
A13856-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13856
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HOXC4; HOX3; HOX3E; cp19; homeobox C4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HOXC4 (NP_055435.2).
Reactivity Mouse, Rat
Gene ID 3221
Calculated MW 29kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAAS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents