HOXA13 Polyclonal AntibodyHOXA13 Polyclonal Antibody
Move your mouse over image or click to enlarge

HOXA13 Polyclonal Antibody

Cat# Size Price Qty Buy
A13999-200ul 200ul
£332.50
A13999-100ul 100ul
£192.50
A13999-50ul 50ul
£113.75
A13999-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13999
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HOXA13; HOX1; HOX1J; homeobox A13
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-320 of human HOXA13 (NP_000513.2).
Reactivity Human
Gene ID 3209
Calculated MW 39kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents