HOXA11 Polyclonal AntibodyHOXA11 Polyclonal Antibody
Move your mouse over image or click to enlarge

HOXA11 Polyclonal Antibody

Cat# Size Price Qty Buy
A2976-200ul 200ul
£332.50
A2976-100ul 100ul
£192.50
A2976-50ul 50ul
£113.75
A2976-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A2976
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HOXA11; HOX1; HOX1I; RUSAT1; homeobox A11
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HOXA11 (NP_005514.1).
Reactivity Human
Gene ID 3207
Calculated MW 34kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents