HO-1 Polyclonal AntibodyHO-1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HO-1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1346-200ul 200ul
£332.50
A1346-100ul 100ul
£192.50
A1346-50ul 50ul
£113.75
A1346-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1346
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HMOX1; HMOX1D; HO-1; HSP32; bK286B10; heme oxygenase 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human HO-1 (NP_002124.1).
Reactivity Human, Mouse, Rat
Gene ID 3162
Calculated MW 32kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26903296|29605032|29536335|26566260|27840317|29867511|26973173|29923765|29621130
Sequence MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents