HNRNPU Polyclonal AntibodyHNRNPU Polyclonal Antibody
Move your mouse over image or click to enlarge

HNRNPU Polyclonal Antibody

Cat# Size Price Qty Buy
A3917-200ul 200ul
£332.50
A3917-100ul 100ul
£192.50
A3917-50ul 50ul
£113.75
A3917-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3917
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HNRNPU; EIEE54; HNRNPU-AS1; HNRPU; SAF-A; SAFA; U21.1; hnRNP U; hnRNPU; pp120; heterogeneous nuclear ribonucleoprotein U
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 608-825 of human HNRNPU (NP_114032.2).
Reactivity Human, Rat
Gene ID 3192
Calculated MW 88kDa/90kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents