HNRNPCL1 Polyclonal AntibodyHNRNPCL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HNRNPCL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16011-20ul 20ul
£77.00
A16011-50ul 50ul
£113.75
A16011-100ul 100ul
£192.50
A16011-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16011
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HNRNPCL1; HNRPCL1; heterogeneous nuclear ribonucleoprotein C-like 1
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1).
Reactivity Human
Gene ID 343069
Calculated MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents