HNMT Polyclonal AntibodyHNMT Polyclonal Antibody
Move your mouse over image or click to enlarge

HNMT Polyclonal Antibody

Cat# Size Price Qty Buy
A13499-200ul 200ul
£332.50
A13499-100ul 100ul
£192.50
A13499-50ul 50ul
£113.75
A13499-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13499
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HNMT; HMT; HNMT-S1; HNMT-S2; MRT51; histamine N-methyltransferase
Applications IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human HNMT (NP_008826.1).
Reactivity Human, Mouse
Gene ID 3176
Calculated MW 6kDa/14kDa/33kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents