HNF4G Polyclonal AntibodyHNF4G Polyclonal Antibody
Move your mouse over image or click to enlarge

HNF4G Polyclonal Antibody

Cat# Size Price Qty Buy
A16051-20ul 20ul
£77.00
A16051-50ul 50ul
£113.75
A16051-100ul 100ul
£192.50
A16051-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16051
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HNF4G; NR2A2; NR2A3; hepatocyte nuclear factor 4-gamma
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 366-445 of human HNF4G (NP_004124.4).
Reactivity Human, Mouse, Rat
Gene ID 3174
Calculated MW 45kDa/50kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents