HNF4A Polyclonal AntibodyHNF4A Polyclonal Antibody
Move your mouse over image or click to enlarge

HNF4A Polyclonal Antibody

Cat# Size Price Qty Buy
A13998-200ul 200ul
£332.50
A13998-100ul 100ul
£192.50
A13998-50ul 50ul
£113.75
A13998-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13998
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HNF4A; FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF14; hepatocyte nuclear factor 4-alpha
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human HNF4A (NP_000448.3).
Reactivity Human, Mouse
Gene ID 3172
Calculated MW 43-56kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents