HLA-E Polyclonal AntibodyHLA-E Polyclonal Antibody
Move your mouse over image or click to enlarge

HLA-E Polyclonal Antibody

Cat# Size Price Qty Buy
A14206-200ul 200ul
£332.50
A14206-100ul 100ul
£192.50
A14206-50ul 50ul
£113.75
A14206-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14206
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HLA-E; HLA-6.2; QA1; EA1.2; EA2.1; MHC; major histocompatibility complex, class I, E
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human HLA-E (NP_005507.3).
Reactivity Human, Mouse, Rat
Gene ID 3133
Calculated MW 40kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents