Histone H3.3 Polyclonal AntibodyHistone H3.3 Polyclonal Antibody
Move your mouse over image or click to enlarge

Histone H3.3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13824-200ul 200ul
£332.50
A13824-100ul 100ul
£192.50
A13824-50ul 50ul
£113.75
A13824-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13824
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names H3F3A; H3.3A; H3F3; histone H3.3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human H3F3A (NP_002098.1).
Reactivity Human, Mouse, Rat
Gene ID 3020
Calculated MW 15kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29761910
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents