HIC1 Polyclonal AntibodyHIC1 Polyclonal Antibody
Move your mouse over image or click to enlarge

HIC1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13907-200ul 200ul
£332.50
A13907-100ul 100ul
£192.50
A13907-50ul 50ul
£113.75
A13907-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13907
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HIC1; ZBTB29; ZNF901; hic-1; hypermethylated in cancer 1 protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-430 of human HIC1 (NP_001091672.1).
Reactivity Mouse
Gene ID 3090
Calculated MW 74kDa/76kDa
Observed MW 76kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents