HHIP Polyclonal AntibodyHHIP Polyclonal Antibody
Move your mouse over image or click to enlarge

HHIP Polyclonal Antibody

Cat# Size Price Qty Buy
A3260-200ul 200ul
£332.50
A3260-100ul 100ul
£192.50
A3260-50ul 50ul
£113.75
A3260-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3260
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HHIP; HIP; hedgehog-interacting protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-700 of human HHIP (NP_071920.1).
Reactivity Human, Mouse
Gene ID 64399
Calculated MW 36kDa/78kDa
Observed MW 79kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30407707
Sequence DMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents