HAMP Polyclonal AntibodyHAMP Polyclonal Antibody
Move your mouse over image or click to enlarge

HAMP Polyclonal Antibody

Cat# Size Price Qty Buy
A1601-20ul 20ul
£77.00
A1601-50ul 50ul
£113.75
A1601-100ul 100ul
£192.50
A1601-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1601
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HAMP; HEPC; HFE2B; LEAP1; PLTR; hepcidin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human HAMP (NP_066998.1).
Reactivity Human, Mouse
Gene ID 57817
Calculated MW 9kDa
Observed MW 10kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents