GUCY2F Polyclonal AntibodyGUCY2F Polyclonal Antibody
Move your mouse over image or click to enlarge

GUCY2F Polyclonal Antibody

Cat# Size Price Qty Buy
A14242-200ul 200ul
£332.50
A14242-100ul 100ul
£192.50
A14242-50ul 50ul
£113.75
A14242-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14242
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GUCY2F; CYGF; GC-F; GUC2DL; GUC2F; RETGC-2; ROS-GC2; retinal guanylyl cyclase 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-460 of human GUCY2F (NP_001513.2).
Reactivity Mouse, Rat
Gene ID 2986
Calculated MW 124kDa
Observed MW 125kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents