GRK5 Polyclonal AntibodyGRK5 Polyclonal Antibody
Move your mouse over image or click to enlarge

GRK5 Polyclonal Antibody

Cat# Size Price Qty Buy
A3899-200ul 200ul
£332.50
A3899-100ul 100ul
£192.50
A3899-50ul 50ul
£113.75
A3899-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3899
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GRK5; GPRK5; G protein-coupled receptor kinase 5
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 371-590 of human GRK5 (NP_005299.1).
Reactivity Human, Mouse, Rat
Gene ID 2869
Calculated MW 68kDa
Observed MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRNHPPEPPKKGLLQRLFKRQHQNNSKSSPSSKTSFNHHINSNHVSSNSTGSS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents