GPX4 Polyclonal AntibodyGPX4 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPX4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13309-200ul 200ul
£332.50
A13309-100ul 100ul
£192.50
A13309-50ul 50ul
£113.75
A13309-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13309
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPX4; GPx-4; GSHPx-4; MCSP; PHGPx; SMDS; snGPx; snPHGPx; glutathione peroxidase 4
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of human GPX4 (NP_002076.2).
Reactivity Human, Mouse, Rat
Gene ID 2879
Calculated MW 19kDa/22kDa
Observed MW 25kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents