GPX2 Polyclonal AntibodyGPX2 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPX2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15999-20ul 20ul
£77.00
A15999-50ul 50ul
£113.75
A15999-100ul 100ul
£192.50
A15999-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15999
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPX2; GI-GPx; GPRP; GPRP-2; GPx-2; GPx-GI; GSHPX-GI; GSHPx-2; glutathione peroxidase 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2).
Reactivity Human, Mouse, Rat
Gene ID 2877
Calculated MW 21kDa
Observed MW 21kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents