GPR32 Polyclonal AntibodyGPR32 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPR32 Polyclonal Antibody

Cat# Size Price Qty Buy
A16049-20ul 20ul
£77.00
A16049-50ul 50ul
£113.75
A16049-100ul 100ul
£192.50
A16049-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16049
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPR32; RVDR1; G protein-coupled receptor 32
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR32 (NP_001497.1).
Reactivity Human, Mouse, Rat
Gene ID 2854
Calculated MW 40kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents