GP1BA Polyclonal AntibodyGP1BA Polyclonal Antibody
Move your mouse over image or click to enlarge

GP1BA Polyclonal Antibody

Cat# Size Price Qty Buy
A16048-20ul 20ul
£77.00
A16048-50ul 50ul
£113.75
A16048-100ul 100ul
£192.50
A16048-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16048
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GP1BA; BDPLT1; BDPLT3; BSS; CD42B; CD42b-alpha; DBPLT3; GP1B; GPIbA; GPIbalpha; VWDP; platelet glycoprotein Ib alpha chain
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-259 of human GP1BA (NP_000164.5).
Reactivity Human
Gene ID 2811
Calculated MW 71kDa
Observed MW 160kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents