GOSR2 Polyclonal AntibodyGOSR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

GOSR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4321-200ul 200ul
£332.50
A4321-100ul 100ul
£192.50
A4321-50ul 50ul
£113.75
A4321-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4321
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GOSR2; Bos1; EPM6; GS27; Golgi SNAP receptor complex member 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GOSR2 (NP_004278.2).
Reactivity Human
Gene ID 9570
Calculated MW 22kDa/24kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents