GOSR1 Polyclonal AntibodyGOSR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

GOSR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4316-200ul 200ul
£332.50
A4316-100ul 100ul
£192.50
A4316-50ul 50ul
£113.75
A4316-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4316
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GOSR1; GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28; Golgi SNAP receptor complex member 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human GOSR1 (NP_004862.1).
Reactivity Human, Mouse
Gene ID 9527
Calculated MW 21kDa/28kDa
Observed MW 29kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 27661736
Sequence MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDIL
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents